• Best Antiplatelet Drug Endocrine System Hormones Eptifibatide Acetate 148031-34-9 wholesale
    ...Antiplatelet Drug Endocrine System Hormones Eptifibatide Acetate 148031-34-9 Product introduction: Eptifibatide , is an antiplatelet drug of the glycoprotein IIb/IIIa inhibitor class. Eptifibatide is a cyclic ... more
    Brand Name:VANZ
    Model Number:Medical peptides grade
    Place of Origin:CHINA(MAINLAND)

    Antiplatelet Drug Endocrine System Hormones Eptifibatide Acetate 148031-34-9

    Wuhan Vanz Pharm Inc.
    [Hubei,China]
  • Best Estriol Anti Estrogen Steroids Raw Pharmaceutical Active Ingredients 99.9% Purity Cas 50-27-1​ wholesale
    Estriol Anti Estrogen Steroids Raw Pharmaceutical Active Ingredients 99.9% Purity Cas 50-27-1​ Product Description: Estriol belongs to natural hormone and is the metabolite of estradiol in vivo , anti estrogen steroids . It is mainly presented in the ... more
    Brand Name:SR
    Model Number:50-27-1​
    Place of Origin:China

    Estriol Anti Estrogen Steroids Raw Pharmaceutical Active Ingredients 99.9% Purity Cas 50-27-1​

  • Best Clomifene Citrate / Clomid Estrogen Blocker Supplement GMP Powder CAS 50-41-9 wholesale
    Clomifene citrate / Clomid CAS: 50-41-9 Anti Estrogen Steroids GMP Factory Description: Clomifene citrate (Clomid) Another name:2-4-[2-Chloro-1,2-diphenylethenyl]phenoxy-N,N-diethylethanamine citrate Alias:serophene; pergotime; clomphid; Clomid CAS NO: 50... more
    Brand Name:LSW
    Model Number:50-41-9
    Place of Origin:China

    Clomifene Citrate / Clomid Estrogen Blocker Supplement GMP Powder CAS 50-41-9

  • Best Bodybuilding Anabolic Steroids Sermorelin Acetate Peptide White crystalline Powder wholesale
    ...Bodybuilding Anabolic Steroids Sermorelin Acetate Peptide White crystalline Powder Introduction: GH-releasing peptides (GHRPs) are synthetic peptides that like GHRH act directly on pituitary somatotrophs ... more
    Brand Name:Sermorelin
    Model Number:87616-84-0
    Place of Origin:china

    Bodybuilding Anabolic Steroids Sermorelin Acetate Peptide White crystalline Powder

    Pharmlab Co.,Ltd
    [Hubei,China]
  • Best Free Software Quantum Resonance Magnetic Analyzer Machine CE Certification wholesale
    ...Free Software Quantum Resonance Magnetic Analyzer Machine CE Certification Introduction The Quantum Magnetic Resonance Analyzer replaces the need for ultrasonic, nuclear magnetic resonance or radiography ... more
    Brand Name:huge
    Model Number:Q41
    Place of Origin:China

    Free Software Quantum Resonance Magnetic Analyzer Machine CE Certification

  • Best Injectable Anabolic Trenbolone Steroids / Trenbolone Enanthate Parabolan CAS 10161-33-8 wholesale
    ... C25H34O3 Molecular weight 382.54 Assay 99% Appearance yellow liquid Usage Hormones and Regulation of Endocrine Function of Drug Product Description: Trenbolone Enanthate, known as “Tren E” or “Tren Enanthate,”Trenbolone... more
    Brand Name:kafenbiotech
    Model Number:10161-33-8
    Place of Origin:China

    Injectable Anabolic Trenbolone Steroids / Trenbolone Enanthate Parabolan CAS 10161-33-8

  • Best Toremifene Citrate Fareston Anti Estrogen Steroid for Breast Cancer Acapodene wholesale
    ...Self Introduction: Our company have been doing this line for more than 10 years, we are experienced ... more
    Brand Name:SMQ
    Model Number:C32H36ClNO8
    Place of Origin:CHINA

    Toremifene Citrate Fareston Anti Estrogen Steroid for Breast Cancer Acapodene

  • Best API Oral Contraceptive Hormone , CAS 68-22-4 Norethisterone For Breast Cancer Cure wholesale
    API Oral Contraceptive Hormone Norethisterone For Breast Cancer Cure CAS 68-22-4 Quick detail Product Name Norethisterone Synonyms Norethisterone,98%; 17-alpha-ethynyl-17-beta-hydroxyoestr-4-en-3-one; Norethisterone; 17-ethynyl-17-hydroxyestr-4-en-3-one; ... more
    Brand Name:Jusheng Brand
    Model Number:68-22-4
    Place of Origin:China

    API Oral Contraceptive Hormone , CAS 68-22-4 Norethisterone For Breast Cancer Cure

  • Best CAS 62-90-8 Legal Cutting Steroids To Build Muscle Nandrolone Phenypropionate Durabolin wholesale
    CAS 62-90-8 Legal Cutting Steroids To Build Muscle Nandrolone Phenypropionate Durabolin Nandrolone phenylpropionate Synonyms: durabolin Chemical Name: 4-estren-17beta-ol-3-one phenylpropionate CAS NO.: 62-90-8 EINECS: 200-551-9 Assay:99% Molecular Formula... more
    Brand Name:YIHAN
    Model Number:Nandrolone Phenylpropionate
    Place of Origin:China

    CAS 62-90-8 Legal Cutting Steroids To Build Muscle Nandrolone Phenypropionate Durabolin

    Yihan Industrial Co.,Ltd.
    [Hongkong,China]
  • Best CAS 86168-78-7 GRF 1-29 Growth Hormone For Bodybuilding Sermorelin Acetate Muscle Gain wholesale
    ...-Leu- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Purity: >98% Bacterial Endotoxins: < 5EU/mg Introduction: Sermorelin, sometimes called GRF 1-29 NH2 with sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2, is an amidated synthetic 29... more
    Brand Name:SGH
    Model Number:86168-78-7
    Place of Origin:China

    CAS 86168-78-7 GRF 1-29 Growth Hormone For Bodybuilding Sermorelin Acetate Muscle Gain

  • Best Purple Grey Quantum Resonance Magnetic Analyzer Korean Spanish wholesale
    2016 Purple&Grey quantum resonance magnetic analyzer (GY-D02) Working with principles of quantum medicine, the Quantum Magnetic Resonance Analyser detects changes in electromagnetic waves emitted by the body’s cells. By holding a sensor in the palm of ... more
    Brand Name:SSCH
    Model Number:GY-D02
    Place of Origin:GUANG DONG, CHINA

    Purple Grey Quantum Resonance Magnetic Analyzer Korean Spanish

  • Best Fatty Acid and Lung Function Quantum Body Scanning Skin Analyzer Machine wholesale
    Fatty Acid and Lung Function Quantum Body Scanning Analyzer Machine 6 report for children 1 ADHD 2 Vitamin 3 Trace element 4 Amino acids 5 Coenzyme 6 Fatty Aicd 41 report for adult 1. Cardiovascular and Cerebrovascular 2. Gastrointestinal Function 3. ... more
    Brand Name:CYM
    Model Number:K30
    Place of Origin:China

    Fatty Acid and Lung Function Quantum Body Scanning Skin Analyzer Machine

  • Best Raw Organic Cucumber Extract Powder 30% Polysaccharide Solvent Extraction wholesale
    ...Water Soluble Vegetable Extract Powder Light Green Cucumber Extract Powder 30% Polysaccharide Introduction of Cucumber Extract Powder Cucumber extract has many benefits for the skin. It actually is a ... more
    Brand Name:BIOF
    Model Number:89998-01-6
    Place of Origin:Shaanxi, China(Mainland)

    Raw Organic Cucumber Extract Powder 30% Polysaccharide Solvent Extraction

  • Best No Pain Professional Galvanic Hair Regrowth Treatment Machine Touch Screen wholesale
    No Pain Professional Galvanic Hair Regrowth Treatment Machine Touch Screen 1. 5 inch touch screen 2. Micro-current comb stimulate scalp ,massage 3. Ozone high frequency comb for hair sterilization. 4. Galanic stimulates scalp absorb the hair tonic. 5. ... more
    Brand Name:Boldness
    Model Number:BL-206
    Place of Origin:China, Guangzhou

    No Pain Professional Galvanic Hair Regrowth Treatment Machine Touch Screen

  • Best KOSHER 2 NaCL D Glucosamine Sulfate Powder 40 Mesh Sodium Chloride White Crystal wholesale
    ... Sodium Chloride We offer Glucosamine sulfate powder KOSHER certified 40 mesh Glucosamine Sulfate 2NaCL powder. Introduction D-Glucosamine Sulfate 2NaCl: D-Glucosamine Sulfate Sodium Chloride N-Sulfo-glucosamine sodium salt: 2-Deoxy-2-sulfoamino-D-glucose... more
    Brand Name:Health Herb
    Model Number:USP
    Place of Origin:CHINA

    KOSHER 2 NaCL D Glucosamine Sulfate Powder 40 Mesh Sodium Chloride White Crystal

  • Best Hydra Facial Skin Care Machines With Water Oxygen Jet Facial Peel System wholesale
    Beauty salon equipment hydra skin care facial machine for salon Work principle The treatment is the newest advance in non-laser skin resurfacing. it is the only hydradermabrasion equipment combining cleansing, exfoliation, extraction, hydration and ... more
    Brand Name:Sunlight
    Model Number:Sun-AVA
    Place of Origin:Beijing of China

    Hydra Facial Skin Care Machines With Water Oxygen Jet Facial Peel System

    Beijing Sunlight Co. Ltd.
    [Beijing,China]
  • Best Plant Extract Oil Evening Primrose Oil for balancing female endocrine hormones wholesale
    ...Introduction Evening primrose originates from Mexico and Central America, now grows abundantly in northeast of China. ... more
    Brand Name:Baili
    Place of Origin:Jilin/China
    Certification:FDA/NOP/GMP/HACCP/ISO9001:2008/ISO22000:2005/KOSHER/HALAL

    Plant Extract Oil Evening Primrose Oil for balancing female endocrine hormones

  • Best Health Food, Wolfberry Fruit Tea, 100% Natural Wild Black Chinese Wolfberry Dried Fruit, Anticancer,Antiaging,Whitening, wholesale
    QingHai Qaidam Lycium ruthenicum Murray Specification: BCS certificated black wolfberry Package: 50g/bottle,100g/bottle,250g/bag, 500g/bag, 1kg/box, 10kg/box, 20kg/box Origin: Qinghai Qaidam Basin Class: No additives Notlice: must be moistureproof (... more
    Brand Name:AmorBerry
    Model Number:Wild black goji berry
    Place of Origin:QINGHAI

    Health Food, Wolfberry Fruit Tea, 100% Natural Wild Black Chinese Wolfberry Dried Fruit, Anticancer,Antiaging,Whitening,

  • Best GD/A19002 Endocrine Organ Model(GD/A19002) wholesale
    Introduction Features: The model is mounted on a base and display endocrine gland and endocrine tissue. It consists of pituitary gland, thyroid gland, parathyroid gland, adrenal gland, pancreatic island, testicle and ovary. Material: Advanced PVC more
    Categories:Hyaluronic Acid Injections For Buttocks
    Telephone:86-21-55964925
    Country/Region:china

    GD/A19002 Endocrine Organ Model(GD/A19002)

  • Best Rat Endocrine Gland Derived Vascular Endothelial Growth Factor (EG-VEGF) ELISA Kit wholesale
    ... stored at 4℃ Faster reaction compare to other brands 12 months shelf life Instruction Manual Introduction Item Standard Test Description The kit is a sandwich enzyme immunoassay for the in vitro quantitative... more
    Categories:Epidermal Growth Factor
    Telephone:+86-510-82732223,778-477-6628
    Country/Region:china

    Rat Endocrine Gland Derived Vascular Endothelial Growth Factor (EG-VEGF) ELISA Kit

Tell “introduction to endocrine system” Suppliers Your Requirement
*E-mail:
* Message:
Characters Remaining: (0/3000)
Inquiry Cart 0