Sign In | Join Free | My fazendomedia.com
fazendomedia.com
Products
Search by Category
Home > Chemicals > Polymer >

Raw Steroid Powder Uk

1-10 Results for

raw steroid powder uk

from 9280 Products

buy Testosterone Cypionate Raw Steroid Powders Testosterone Cypionate Dihydroboldenone DHB Muscle Building

China buy Testosterone Cypionate Raw Steroid Powders Testosterone Cypionate  Dihydroboldenone DHB Muscle Building on sale
...buy Testosterone Cypionate Raw Steroid Powders Testosterone Cypionate Dihydroboldenone DHB Muscle Building ============================== Whatsapp:+86 18953989203 Wickr:onlinebestchem Skype:live:dfdd9a9b8016090e Email:......
Shandong Chuangrui Chemical Technology Co., Ltd.

Address: shandong province, China

Tetracaine Hydrochloride Raw Steroid Powders White Powder Form CAS 120-51-4

China Tetracaine Hydrochloride Raw Steroid Powders White Powder Form CAS 120-51-4 on sale
...Tetracaine hydrochloride Raw Steroid Powders Tetracaine HCL Safe Clearance EU,USA,UK,France Quick details: Chemical name:Benzyl Benzoate Alias: benzoic acid benzyl ester; benzyl benzoate; BB ......
GZ Body Chemical Co., Limited

Address: Room 1001, 1th building, park, LiJing road, YueXiu district, GuangZhou, China

Desloratadine Raw Steroid Powder For Relief Allergic Rhinitis Pharmacy , No 100643-71-8

China Desloratadine Raw Steroid Powder For Relief Allergic Rhinitis Pharmacy ,  No 100643-71-8 on sale
...Desloratadine Raw Steroid Powder For Relief Allergic Rhinitis Pharmacy , No 100643-71-8 Desloratadine English Synonyms: DESLORATADINE;DESLORATIDINE;8-chloro-6,11-......
Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd

Address: 496, Zhongshan Road, Wuhan, China

Methenolone Enanthate Raw Steroid Powder For Muscle Gain and Growth Hormone Bodybuilding

China Methenolone Enanthate Raw Steroid Powder For Muscle Gain and Growth Hormone Bodybuilding on sale
...Methenolone Enanthate Raw Steroid Powder For Muscle Gain and growth hormone bodybuilding Quick Detail: Methenolone Enanthate Alias: Primobolan-depot; meth ......
Shenzhen Haiwen Biotechnology Co.,Ltd

Address: #2 New District Road, Minzhi Street, Longhua New District, Shenzhen, China

Raw steroid powder Anti Aging Dehydroepiandrosterone / DHEA Raw Steroid Powders Pharmaceutical

China Raw steroid powder Anti Aging Dehydroepiandrosterone / DHEA Raw Steroid Powders Pharmaceutical on sale
...Raw steroid powder Anti Aging Dehydroepiandrosterone / DHEA Raw Steroid Powders Pharmaceutical Whatsapp:+86 18953989203 Wickr:onlinebestchem Skype:live:dfdd9a9b8016090e Email:chemresearchchemicalshop@gmail.com Quick Detail: 1.......
Shandong Shengri Chemical Co., Ltd.

Address: Lanshan district, linyi city, shandong province, China

Pharmaceutical Raw Steroid Powders , Testosterone Decanoate Steroid Raws

China Pharmaceutical Raw Steroid Powders , Testosterone Decanoate Steroid Raws on sale
...steroid raws Testosterone Decanoate Powder steroid raws Pharmaceutical raw materials, Steroid hormone, Anabolin 1. Why choose us 1. Rich experience We specialize in this filed for many years,......
RCchemshop

Address: 1504, Block B, Beijing Road Global Center, Liuqing Street, Lanshan District, Linyi City, Shandong Province

Pharmaceutical Intermediate Methenolone Enanthate / Primobolan Depot Raw Steroid Powder CAS 303-42-4

China Pharmaceutical Intermediate Methenolone Enanthate / Primobolan Depot Raw Steroid Powder CAS 303-42-4 on sale
...Pharmaceutical Intermediate Methenolone Enanthate / Primobolan Depot Raw Steroid Powder CAS 303-42-4 Quick detail: Product name: Methenolone enanthate Synonyms: Primobolan Depot; Primo; PRIMOBOLAN-DEPOT; ......
Yihan Industrial Co.,Ltd.

Address: 1st Building,JingNan Industrial Zone,JingNan Road,BuJi Town,LongGang District,ShenZhen,China,518000

Legit Oral Raw Steroid Powders Winstrol / Stanozolol For Bodybuilding CAS 10418-03-8

China Legit Oral Raw Steroid Powders Winstrol / Stanozolol For Bodybuilding CAS 10418-03-8 on sale
...Detailed Product Description Legit Oral Raw Steroid Powders Winstrol / Stanozolol For Bodybuilding CAS 10418-03-8 Quick Detail: Product name Stanozolol Factory Supplying Other ......
Shanghai Taigui Pharmaceutical Technology Co., Ltd

Address: the No 4 building, No1628 lizheng Road,Pudong new area,Shanghai,china

Off - White Crystalline Raw Steroid Powders / Muscle Growth Hormone For Bodybuilding from USA Shipping

China Off - White Crystalline Raw Steroid Powders / Muscle Growth Hormone For Bodybuilding from USA Shipping on sale
...-Leu-Ser-Arg-NH2 Molecular formula: C152H252N44O42 Molecular weight: 3367.97 Purity: 98% Traits: white powder CJC-1295 without DAC, a 29-amino acid peptide with sequence Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2, is a tetrasubstituted peptide......
Zhuhai Jiacheng Bio-Tech Co., Ltd.

Address: Room C, 23rd Floor, Block 3 La Cite, Areia Preta, Macao

White Estradiol Raw Steroid Powders Infrared Absorption High Pure

China White Estradiol Raw Steroid Powders Infrared Absorption High Pure on sale
...White Estradiol Raw Steroid Powders Infrared Absorption High Pure Product Details: 1, Manufacturer :Holy Biological 2, MF:C18H24O2 3, MW:272.38 4, Purity:99% 5, Character: White Crystalline Powder 6, Stability: Stable. Incompatible with strong oxidizing ......
Hubei Holy Biological Co., Ltd.

Address: #16, Zhongnan Road, Wuchang District, Wuhan, China

Submit your raw steroid powder uk inquiry in a minute :
*From:
Your email address is incorrect!
To:

Hubei Holy Biological Co., Ltd.

Products: White Estradiol Raw Steroid Powders Infrared Absorption High Pure

*Subject:
Your subject must be between 10-255 characters!
*Message:
For the best results, we recommend including the following details:
  • --Self introduction
  • --Required specifications
  • --Inquire about price/MOQ
Your message must be between 20-3,000 characters!
 
Please reply me within 24 hours.
Yes! I would like your verified suppliers matching service!
Yes! If this supplier doesn't contact me in 3 days, I want everychina.com to recommend me more suppliers.
Submit raw steroid powder uk inquiry
*From:
Your email address is incorrect!
*Subject:
Your subject must be between 10-255 characters!
*Message:
For the best results, we recommend including the following details:
  • --Self introduction
  • --Required specifications
  • --Inquire about price/MOQ
Your message must be between 20-3,000
Yes! I would like your verified suppliers matching service!
Inquiry Cart 0